SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000365773 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000365773
Domain Number 1 Region: 6-367
Classification Level Classification E-value
Superfamily PLP-dependent transferases 7.3e-110
Family GABA-aminotransferase-like 0.0000000626
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000365773   Gene: ENSG00000135069   Transcript: ENST00000376588
Sequence length 370
Comment pep:known chromosome:GRCh37:9:80912059:80945009:1 gene:ENSG00000135069 transcript:ENST00000376588 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDAPRQVVNFGPGPAKLPHSVLLEIQKELLDYKGVGISVLEMSHRSSDFAKIINNTENLV
RELLAVPDNYKVIFLQGGGCGQFSAVPLNLIGLKAGRCADYVVTGAWSAKAAEEAKKFGT
INIVHPKLGSYTKIPDPSTWNLNPDASYVYYCANETVHGVEFDFIPDVKGAVLVCDMSSN
FLSKPVDVSKFGVIFAGAQKNVGSAGVTVVIVRDDLLGFALRECPSVLEYKVQAGNSSLY
NTPPCFSIYVMGLVLEWIKNNGGAAAMEKLSSIKSQTIYEIIDNSQGFYVCPVEPQNRSK
MNIPFRIGNAKGDDALEKRFLDKALELNMLSLKGHRSVGGIRASLYNAVTIEDVQKLAAF
MKKFLEMHQL
Download sequence
Identical sequences A0A024R222 G3RHI3 K7CJE6 Q9Y617
9606.ENSP00000365773 ENSP00000317606 ENSP00000365773 gi|17402893|ref|NP_478059.1| ENSP00000365773 NP_478059.1.87134 NP_478059.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]