SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000366268 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000366268
Domain Number 1 Region: 2-149
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 1.44e-44
Family Integrin alpha N-terminal domain 0.000000059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000366268   Gene: ENSG00000005961   Transcript: ENST00000377068
Sequence length 219
Comment pep:known chromosome:GRCh37:17:42457425:42462688:-1 gene:ENSG00000005961 transcript:ENST00000377068 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASYFGHSVAVTDVNGDGRHDLLVGAPLYMESRADRKLAEVGRVYLFLQPRGPHALGAPS
LLLTGTQLYGRFGSAIAPLGDLDRDGYNDIAVAAPYGGPSGRGQVLVFLGQSEGLRSRPS
QVLDSPFPTGSAFGFSLRGAVDIDDNGYPGALDCLQLEMPKKGPWTFAGSAKRHGQGLMP
GLVSHYGLPEGLGETSSGGGGVGNPWEDEMRIPCPNRQF
Download sequence
Identical sequences B7Z8B0
ENSP00000366268

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]