SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000367206 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000367206
Domain Number 1 Region: 3-129
Classification Level Classification E-value
Superfamily RNI-like 9.42e-16
Family Cyclin A/CDK2-associated p19, Skp2 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000367206   Gene: ENSG00000079691   Transcript: ENST00000377969
Sequence length 176
Comment pep:known chromosome:GRCh37:6:25279875:25479475:1 gene:ENSG00000079691 transcript:ENST00000377969 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYACVCDWLGFSYREEVQWDVDTIYLTQDTRELNLQDFSHLDHRDLIPIIAALEYNQWFT
KLSSKDLKLSTDVCEQILRVVSRSNRLEELVLENAGLRTDFAQKLASALAHNPNSGLHTI
NLAGNPLEDRETTTKIKRQNVPTVLQTYLVVCPSDYQPCPLPLGKDNYYSDFSHDG
Download sequence
Identical sequences ENSP00000367206

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]