SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000367207 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000367207
Domain Number 1 Region: 368-450
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 1.28e-17
Family HLH, helix-loop-helix DNA-binding domain 0.00000656
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000367207   Gene: ENSG00000136997   Transcript: ENST00000377970
Sequence length 454
Comment pep:known chromosome:GRCh37:8:128748330:128753674:1 gene:ENSG00000136997 transcript:ENST00000377970 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LDFFRVVENQQPPATMPLNVSFTNRNYDLDYDSVQPYFYCDEEENFYQQQQQSELQPPAP
SEDIWKKFELLPTPPLSPSRRSGLCSPSYVAVTPFSLRGDNDGGGGSFSTADQLEMVTEL
LGGDMVNQSFICDPDDETFIKNIIIQDCMWSGFSAAAKLVSEKLASYQAARKDSGSPNPA
RGHSVCSTSSLYLQDLSAAASECIDPSVVFPYPLNDSSSPKSCASQDSSAFSPSSDSLLS
STESSPQGSPEPLVLHEETPPTTSSDSEEEQEDEEEIDVVSVEKRQAPGKRSESGSPSAG
GHSKPPHSPLVLKRCHVSTHQHNYAAPPSTRKDYPAAKRVKLDSVRVLRQISNNRKCTSP
RSSDTEENVKRRTHNVLERQRRNELKRSFFALRDQIPELENNEKAPKVVILKKATAYILS
VQAEEQKLISEEDLLRKRREQLKHKLEQLRNSCA
Download sequence
Identical sequences A0A087WUS5
ENSP00000478887 ENSP00000479618 9606.ENSP00000367207 ENSP00000367207 ENSP00000367207

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]