SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000367436 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000367436
Domain Number 1 Region: 118-322
Classification Level Classification E-value
Superfamily PLP-dependent transferases 4.45e-35
Family GABA-aminotransferase-like 0.00055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000367436   Gene: ENSG00000172296   Transcript: ENST00000378194
Sequence length 329
Comment pep:known chromosome:GRCh37:20:12989822:13140975:1 gene:ENSG00000172296 transcript:ENST00000378194 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MANPGGGAVCNGKLHNHKKQSNGSQSRNCTKNGIVKEAQQNGKPHFYDKLIVESFEEAPL
HVMVFTYMGYGIGTLFGYLRDFLRNWGIEKCNAAVERKEQKDFVPLYQDFENFYTRNLYM
RIRDNWNRPICSAPGPLFDLMERVSDDYNWTFRFTGRVIKDVINMGSYNFLGLAAKYDES
MRTIKDVLEVYGTGVASTRHEMGTLDKHKELEDLVAKFLNVEAAMVFGMGFATNSMNIPA
LVGKGCLILSDELNHTSLVLGARLSGATIRIFKHNNTQSLEKLLRDAVIYGQPRTRRAWK
KILILVEGVYRTSWIIYGFTRIVLFMLHP
Download sequence
Identical sequences ENSP00000367436

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]