SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000368109 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000368109
Domain Number 1 Region: 159-552
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.44e-74
Family GABA-aminotransferase-like 0.0000338
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000368109   Gene: ENSG00000205126   Transcript: ENST00000378832
Sequence length 568
Comment pep:known chromosome:GRCh37:11:44069531:44081527:1 gene:ENSG00000205126 transcript:ENST00000378832 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSHRSDTLPVPSGQRRGRVPRDHSIYTQLLEITLHLQQAMTEHFVQLTSRQGLSLEERRH
TEAICEHEALLSRLICRMINLLQSGAASGLELQVPLPSEDSRGDVRYGQRAQLSGQPDPV
PQLSDCEAAFVNRDLSIRGIDISVFYQSSFQDYNAYQKDKYHKDKNTLGFINLGTSENKL
CMDLMTERLQESDMNCIEDTLLQYPDWRGQPFLREEVARFLTYYCRAPTRLDPENVVVLN
GCCSVFCALAMVLCDPGEAFLVPAPFYGGFAFSSRLYAKVELIPVHLESEVTVTNTHPFQ
LTVDKLEEALLEARLEGKKVRGLVLINPQNPLGDIYSPDSLMKYLEFAKRYNLHVIIDEI
YMLSVFDESITFHSILSMKSLPDSNRTHVIWGTSKDFGISGFRFGALYTHNKEVASAVSA
FGYLHSISGITQHKLCQLLQNTEWIDKVYLPTNCYRLREAHKYITAELKALEIPFHNRSS
GLYVWINLKKYLDPCTFEEERLLYCRFLDNKLLLSRGKTYMCKEPGWFCLIFADELPRLK
LAMRRFCDVLQEQKEALIVKQLEDAMRE
Download sequence
Identical sequences Q4AC99
gi|149944424|ref|NP_001027025.2| ENSP00000368109 ENSP00000368109 9606.ENSP00000368109 ENSP00000368109 NP_001027025.2.87134 NP_001027025.2.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]