SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000368429 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000368429
Domain Number 1 Region: 96-171
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 6.28e-19
Family HLH, helix-loop-helix DNA-binding domain 0.0000637
Further Details:      
 
Weak hits

Sequence:  ENSP00000368429
Domain Number - Region: 162-202
Classification Level Classification E-value
Superfamily Leucine zipper domain 0.0127
Family Leucine zipper domain 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000368429   Gene: ENSG00000105698   Transcript: ENST00000379134
Sequence length 215
Comment pep:novel chromosome:GRCh37:19:35760005:35770159:1 gene:ENSG00000105698 transcript:ENST00000379134 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDMLDPGLDPAASATAAAAASHDKGPEAEEGVELQEGGDGPGAEEQTAVAITSVQQAAFG
DHNIQYQFRTETNGGQTGTQRTIAPRTHPYSPKIDGTRTPRDERRRAQHNEVERRRRDKI
NNWIVQLSKIIPDCNADNSKTGASKGGILSKACDYIRELRQTNQRMQETFKEAERLQMDN
ELLRQQIEELKNENALLRAQLQQHNLEMVGEGTRQ
Download sequence
Identical sequences A0A2J8QHC3 A0A2J8RRC0
NP_001308079.1.87134 NP_001308079.1.92137 ENSP00000368429 ENSP00000368429

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]