SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000369172 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000369172
Domain Number 1 Region: 39-345
Classification Level Classification E-value
Superfamily PLP-dependent transferases 3.48e-89
Family Pyridoxal-dependent decarboxylase 0.00029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000369172   Gene: ENSG00000139631   Transcript: ENST00000379843
Sequence length 346
Comment pep:known chromosome:GRCh37:12:53551448:53574430:-1 gene:ENSG00000139631 transcript:ENST00000379843 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADSEALPSLAGDPVAVEALLRAVFGVVVDEAIQKGTSVSQKCHYSIQKGAAFLGLGTDS
VRVVKADERGKMVPEDLERQIGMAEAEGAVPFLVSATSGTTVLGAFDPLEAIADVCQRHG
LWLHVDAAWGGSVLLSQTHRHLLDGIQRADSVAWNPHKLLAAGLQCSALLLQDTSNLLKR
CHGSQASYLFQQDKFYDVALDTGDKVVQCGRRVDCLKLWLMWKAQGDQGLERRIDQAFVL
ARYLVEEMKKREGFELVMEPEFVNVCFWFVPPSLRGKQESPDYHERLSKVAPVLKERMVK
EGSMMIGYQPHGTRGNFFRVVVANSALTCADMDFLLNELERLGQDL
Download sequence
Identical sequences A0A2I3SPT9
XP_003831082.1.60992 ENSP00000369172 ENSP00000369175 ENSP00000369175

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]