SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000369286 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000369286
Domain Number 1 Region: 42-159
Classification Level Classification E-value
Superfamily E set domains 0.000000793
Family ML domain 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000369286   Gene: ENSG00000112799   Transcript: ENST00000379953
Sequence length 162
Comment pep:known chromosome:GRCh37:6:6588341:6655216:1 gene:ENSG00000112799 transcript:ENST00000379953 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKGFTATLFLWTLIFPSCSGGGGGKAWPTHVVCSDSGLEVLYQSCDPLQDFGFSVEKCSK
QLKSNINIRFGIILREDIKELFLDLALMSQGSSVLNFSYPICEAALPKFSFCGRRKGEQI
YYAGPVNNPEFTIPQGEYQVLLELYTEKRSTVACANATIMCS
Download sequence
Identical sequences O95711
ENSP00000230568 ENSP00000369286 ENSP00000230568 ENSP00000369286 gi|4758708|ref|NP_004262.1| NP_004262.1.87134 NP_004262.1.92137 ENSP00000230568 9606.ENSP00000230568 HR95

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]