SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000369666 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000369666
Domain Number 1 Region: 440-666
Classification Level Classification E-value
Superfamily RNI-like 1.18e-29
Family Cyclin A/CDK2-associated p19, Skp2 0.038
Further Details:      
 
Domain Number 2 Region: 81-152
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000403
Family PHD domain 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000369666   Gene: ENSG00000099364   Transcript: ENST00000380310
Sequence length 694
Comment pep:known chromosome:GRCh37:16:30935896:30960104:1 gene:ENSG00000099364 transcript:ENST00000380310 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGMKVPGKGESGPSALLTPPMSSSSRGPGAGARRRRTRCRRCRACVRTECGDCHFCRDMK
KFGGPGRMKQSCLLRQCTAPVLPHTAVCLLCGEAGKEDTVEGEEEKFGLSLMECTICNEI
VHPGCLKMGKAEGVINAEIPNCWECPRCTQEGRTSKDSGEGPGRRRADNGEEGASLGSGW
KLTEEPPLPPPPPRRKGPLPAGPPPEDVPGPPKRKEREAGNEPPTPRKKVKGGRERHLKK
VGGDACLLRGSDPGGPGLLPPRVLNPSQAFSSCHPGLPPENWEKPKPPLASAEGPAVPSP
SPQREKLERFKRMCQLLERVPDTSSSSSDSDSDSDSSGTSLSEDEAPGEARNGRRPARGS
SGEKENRGGRRAVRPGSGGPLLSWPLGPAPPPRPPQLERHVVRPPPRSPEPDTLPLAAGS
DHPLPRAAWLRVFQHLGPRELCICMRVCRTWSRWCYDKRLWPRMDLSRRKSLTPPMLSGV
VRRQPRALDLSWTGVSKKQLMWLLNRLQGLQELVLSGCSWLSVSALGSAPLPALRLLDLR
WIEDVKDSQLRELLLPPPDTKPGQTESRGRLQGVAELRLAGLELTDASLRLLLRHAPQLS
ALDLSHCAHVGDPSVHLLTAPTSPLRETLVHLNLAGCHRLTDHCLPLFRRCPRLRRLDLR
SCRQLSPEACARLAAAGPPGPFRCPEEKLLLKDS
Download sequence
Identical sequences A0A2I3SH00 G3QM37 Q6PCT2
9606.ENSP00000369666 gi|157168349|ref|NP_001093254.2| NP_001093254.2.87134 NP_001093254.2.92137 XP_016785217.1.37143 ENSP00000397913 ENSP00000369666 ENSP00000369666

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]