SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000369908 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000369908
Domain Number 1 Region: 87-222
Classification Level Classification E-value
Superfamily TNF-like 2.94e-36
Family TNF-like 0.00000039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000369908   Gene: ENSG00000161955   Transcript: ENST00000380535
Sequence length 222
Comment pep:known chromosome:GRCh37:17:7462076:7464384:1 gene:ENSG00000161955 transcript:ENST00000380535 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPASSPFLLAPKGPPGNMGGPVREPALSVALWLSWGAALGAVACAMALLTQQTELQSLRR
EVSRLQGTGGPSQNGEGYPWQSLPEQHSVLHLVPINATSKDDSDVTEVMWQPALRRGRGL
QAQGYGVRIQDAGVYLLYSQVLFQDVTFTMGQVVSREGQGRQETLFRCIRSMPSHPDRAY
NSCYSAGVFHLHQGDILSVIIPRARAKLNLSPHGTFLGFVKL
Download sequence
Identical sequences NP_001185552.1.87134 NP_001185552.1.92137 ENSP00000369908 gi|310750387|ref|NP_001185552.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]