SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000370029 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000370029
Domain Number 1 Region: 231-314
Classification Level Classification E-value
Superfamily E set domains 5.42e-20
Family E-set domains of sugar-utilizing enzymes 0.08
Further Details:      
 
Weak hits

Sequence:  ENSP00000370029
Domain Number - Region: 321-371
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00189
Family HLH, helix-loop-helix DNA-binding domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000370029   Gene: ENSG00000164330   Transcript: ENST00000380654
Sequence length 560
Comment pep:known chromosome:GRCh37:5:158125672:158526701:-1 gene:ENSG00000164330 transcript:ENST00000380654 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFGIQESIQRSGSSMKEEPLGSGMNAVRTWMQGAGVLDANTAAQSGVGLARAHFEKQPPS
NLRKSNFFHFVLALYDRQGQPVEIERTAFVGFVEKEKEANSEKTNNGIHYRLQLLYSNGI
RTEQDFYVRLIDSMTKQAIVYEGQDKNPEMCRVLLTHEIMCRFFLKFFLKCNQNCLKNAG
NPRDMRRFQVVVSTTVNVDGHVLAVSDNMFVHNNSKHGRRARRLDPSEATPCIKAISPSE
GWTTGGATVIIIGDNFFDGLQVIFGTMLVWSELITPHAIRVQTPPRHIPGVVEVTLSYKS
KQFCKGTPGRFIYTALNEPTIDYGFQRLQKVIPRHPGDPERLPKEVILKRAADLVEALYG
MPHNNQEIILKRAADIAEALYSVPRNHNQLPALANTSVHAGMMGVNSFSGQLAVNVSEAS
QATNQGFTRNSSSVSPHGYVPSTTPQQTNYNSVTTSMNGYGSAAMSNLGGSPTFLNGSAA
NSPYAIVPSSPTMASSTSLPSNCSSSSGIFSFSPANMVSAVKQKSAFAPVVRPQTSPPPT
CTSTNGNSLQAISGMIVPPM
Download sequence
Identical sequences A0A096NGI8 A0A2I3HEP5 A0A2I3RBL8 A0A2J8X6V7 A0A2K5EVG1 A0A2K5NLS0 A0A2K5RVJ6 A0A2K5WH48 A0A2K6BUI8 A0A2K6FKJ4 A0A2K6NZG5 F7F010 G3RKL1
NP_874367.1.87134 NP_874367.1.92137 XP_003268639.1.23891 XP_003782044.1.62490 XP_007613573.1.28591 XP_012500248.1.63892 XP_021067659.1.100879 ENSP00000370029 ENSP00000370029

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]