SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000370371 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000370371
Domain Number 1 Region: 1-322
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.75e-109
Family Pyridoxal-dependent decarboxylase 0.0000000000373
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000370371   Gene: ENSG00000132437   Transcript: ENST00000380984
Sequence length 338
Comment pep:putative chromosome:GRCh37:7:50560345:50628745:-1 gene:ENSG00000132437 transcript:ENST00000380984 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNASEFRRRGKEMVDYMANYMEGIEGRQVYPDVEPGYLRPLIPAAAPQEPDTFEDIINDV
EKIIMPGVTHWHSPYFFAYFPTASSYPAMLADMLCGAIGCIGFSWAASPACTELETVMMD
WLGKMLELPKAFLNEKAGEGGGVIQGSASEATLVALLAARTKVIHRLQAASPELTQAAIM
EKLVAYSSDQAHSSVERAGLIGGVKLKAIPSDGNFAMRASALQEALERDKAAGLIPFFMV
ATLGTTTCCSFDNLLEVGPICNKEDIWLHVDAAYAGSAFICPEFRHLLNGVEFADSFNFN
PHKWLLVNFDCSAMWSRQPVRMLRLKKTCLVSAVVRRS
Download sequence
Identical sequences ENSP00000370371 ENSP00000370371

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]