SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000371200 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000371200
Domain Number 1 Region: 168-319
Classification Level Classification E-value
Superfamily E set domains 9.1e-25
Family Arrestin/Vps26-like 0.044
Further Details:      
 
Domain Number 2 Region: 10-161
Classification Level Classification E-value
Superfamily E set domains 1.96e-18
Family Arrestin/Vps26-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000371200   Gene: ENSG00000205784   Transcript: ENST00000381781
Sequence length 342
Comment pep:known chromosome:GRCh37:19:4890449:4902879:-1 gene:ENSG00000205784 transcript:ENST00000381781 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGDREECLSTPQPPMSVVKSIELVLPEDRIYLAGSSIKGQVILTLNSTLVDPIVKVELVG
RGYVEWSEEAGASCDYSRNVICNNKADYVHKTKTFPVEDNWLSAGSHTFDFHFNLPPRLP
STFTSKFGHVFYFVQASCMGREHILAKKRMYLLVQGTSTFHKETPFQNPLFVEAEEKVSY
NCCRQGTVCLQIQMERNTFTPGEKVVFTTEINNQTSKCIKTVVFALYAHIQYEGFTPSAE
RRSRLDSSELLRQEANTPVTRFNTTKVVSTFNLPLLLSVSSSTQDGEIMHTRYELVTTVH
LPWSLTSLKAKVPIIITSASVDSAICQLSEDGVLPVNPDHQN
Download sequence
Identical sequences A6NEK1
NP_001073992.1.87134 NP_001073992.1.92137 9606.ENSP00000371200 ENSP00000371200 ENSP00000371200 gi|122937478|ref|NP_001073992.1| ENSP00000371200

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]