SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000371257 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000371257
Domain Number 1 Region: 387-528
Classification Level Classification E-value
Superfamily RNI-like 6.08e-30
Family 28-residue LRR 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000371257   Gene: ENSG00000179583   Transcript: ENST00000381835
Sequence length 546
Comment pep:novel chromosome:GRCh37:16:10971067:11018294:1 gene:ENSG00000179583 transcript:ENST00000381835 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRCLAPRPAGSYLSEPQGSSQCATMELGPLEGGYLELLNSDADPLCLYHFYDQMDLAGEE
EIELYSEPDTDTINCDQFSRLLCDMEGDEETREAYANIAELDQYVFQDSQLEGLSKDIFK
HIGPDEVIGESMEMPAEVGQKSQKRPFPEELPADLKHWKPVPFSSSSLSCLNLPEGPIQF
VPTISTLPHGLWQISEAGTGVSSIFIYHGEVPQASQVPPPSGFTVHGLPTSPDRPGSTSP
FAPSATDLPSMPEPALTSRANMTEHKTSPTQCPAAGEVSNKLPKWPGLAWSPCLGLRPSL
HRAALSDTVALWESLQQHGETKLLQAAEEKFTIEPFKAKSLKDVEDLGKLVQTQRTRSSS
EDTAGELPAVRDLKKLEFALGPVSGPQAFPKLVRILTAFSSLQHLDLDALSENKIGDEGV
SQLSATFPQLKSLETLNLSQNNITDLGAYKLAEALPSLAASLLRLSLYNNCICDVGAESL
ARVLPDMVSLRVMDVQYNKFTAAGAQQLAASLRRCPHVETLAMWTPTIPFSVQEHLQQQD
SRISLR
Download sequence
Identical sequences ENSP00000371257 ENSP00000371257 NP_001273332.1.87134 NP_001273332.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]