SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000371785 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000371785
Domain Number 1 Region: 104-177
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000000000055
Family HLH, helix-loop-helix DNA-binding domain 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000371785   Gene: ENSG00000184221   Transcript: ENST00000382348
Sequence length 271
Comment pep:known chromosome:GRCh37:21:34442450:34444726:1 gene:ENSG00000184221 transcript:ENST00000382348 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYYAVSQARVNAVPGTMLRPQRPGDLQLGASLYELVGYRQPPSSSSSSTSSTSSTSSSST
TAPLLPKAAREKPEAPAEPPGPGPGSGAHPGGSARPDAKEEQQQQLRRKINSRERKRMQD
LNLAMDALREVILPYSAAHCQGAPGRKLSKIATLLLARNYILLLGSSLQELRRALGEGAG
PAAPRLLLAGLPLLAAAPGSVLLAPGAVGPPDALRPAKYLSLALDEPPCGQFALPGGGAG
GPGLCTCAVCKFPHLVPASLGLAAVQAQFSK
Download sequence
Identical sequences Q8TAK6
ENSP00000371785 NP_620450.2.87134 NP_620450.2.92137 ENSP00000331066 gi|237757328|ref|NP_620450.2| ENSP00000371785

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]