SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000371805 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000371805
Domain Number 1 Region: 92-204,314-429,471-492,541-633
Classification Level Classification E-value
Superfamily RNI-like 1.23e-16
Family 28-residue LRR 0.056
Further Details:      
 
Domain Number 2 Region: 13-75
Classification Level Classification E-value
Superfamily F-box domain 0.0000000245
Family F-box domain 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000371805   Gene: ENSG00000155034   Transcript: ENST00000382368
Sequence length 718
Comment pep:known chromosome:GRCh37:7:5520189:5553429:-1 gene:ENSG00000155034 transcript:ENST00000382368 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASSGEDISNDDDDMHPAAAGMADGVHLLGFSDEILLHILSHVPSTDLILNVRRTCRKLA
ALCLDKSLIHTVLLQKDYQASEDKVRQLVKEIGREIQQLSMAGCYWLPGSTVEHVARCRS
LVKVNLSGCHLTSLRLSKMLSALQHLRSLAIDVSPGFDASQLSSECKATLSRVRELKQTL
FTPSYGVVPCCTSLEKLLLYFEILDRTREGAILSGQLMVGQSNVPHYQNLRVFYARLAPG
YINQEVVRLYLAVLSDRTPQNLHAFLISVPGSFAESGATKNLLDSMARNVVLDALQLPKS
WLNGSSLLQHMKFNNPFYFSFSRCTLSGGHLIQQVINGGKDLRSLASLNLSGCVHCLSPD
SLLRKAEDDIDSSILETLVASCCNLRHLNLSAAHHHSSEGLGRHLCQLLARLRHLRSLSL
PVCSVADSAPRADRAPAQPAMHAVPRGFGKKVRVGVQSCPSPFSGQACPQPSSVFWSLLK
NLPFLEHLELIGSNFSSAMPRNEPAIRNSLPPCSRAQSVGDSEVAAIGQLAFLRHLTLAQ
LPSVLTGSGLVNIGLQCQQLRSLSLANLGMMGKVVYMPALSDMLKHCKRLRDLRLEQPYF
SANAQFFQALSQCPSLQRLCLVSRSGTLQPDAVLAFMARCLQVVMCHLFTGESLATCKSL
QQSLLRSFQAERPALNVVIFPLLHEGLTDVIRDVPLVHLDEITLFKSRVAEEPPNLWW
Download sequence
Identical sequences A0A024R857
ENSP00000371805 NP_079239.3.87134 NP_079239.3.92137 9606.ENSP00000371805 ENSP00000371805 gi|157426875|ref|NP_079239.3| NYSGRC-157426875

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]