SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000373328 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000373328
Domain Number 1 Region: 5-75
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.00000000000000628
Family CAD domain 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000373328   Gene: ENSG00000187288   Transcript: ENST00000383817
Sequence length 133
Comment pep:known chromosome:GRCh37:3:9908399:9920740:-1 gene:ENSG00000187288 transcript:ENST00000383817 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEYAMKSLSLLYPKSLSRHVSVRTSVVTQQLLSEPSPKAPRARPCRVSTADRSVRKGIMA
YSLEDLLLKGSFPLGPLQHAGHRPRTAWHLLLPAAAPRCYGGRAAPQGQGLIPYPDLSED
TAVKAQVLGSFPQ
Download sequence
Identical sequences A0A0C4DG75
ENSP00000373328 ENSP00000411356 ENSP00000411356

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]