SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000373883 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000373883
Domain Number 1 Region: 322-492,532-665,726-833
Classification Level Classification E-value
Superfamily Cysteine proteinases 1.81e-86
Family Ubiquitin carboxyl-terminal hydrolase, UCH 0.00056
Further Details:      
 
Domain Number 2 Region: 175-283
Classification Level Classification E-value
Superfamily RING/U-box 2.12e-37
Family Zf-UBP 0.000000665
Further Details:      
 
Domain Number 3 Region: 687-744
Classification Level Classification E-value
Superfamily UBA-like 0.00000000000000105
Family UBA domain 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000373883   Gene: ENSG00000111667   Transcript: ENST00000389231
Sequence length 835
Comment pep:known chromosome:GRCh37:12:6961312:6975784:1 gene:ENSG00000111667 transcript:ENST00000389231 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAELSEEALLSVLPTIRVPKAGDRVHKDECAFSFDTPESEGGLYICMNTFLGFGKQYVER
HFNKTGQRVYLHLRRTRRPKEEDPATGTGDPPRKKPTRLAIGVEGGFDLSEEKFELDEDV
KIVILPDYLEIARDGLGGLPDIVRDRVTSAVEALLSADSASRKQEVQAWDGEVRQVSKHA
FSLKQLDNPARIPPCGWKCSKCDMRENLWLNLTDGSILCGRRYFDGSGGNNHAVEHYRET
GYPLAVKLGTITPDGADVYSYDEDDMVLDPSLAEHLSHFGIDMLKMQKTDKTMTELEIDM
NQRIGEWELIQESGVPLKPLFGPGYTGIRNLGNSCYLNSVVQVLFSIPDFQRKYVDKLEK
IFQNAPTDPTQDFSTQVAKLGHGLLSGEYSKPVPESGDGERVPEQKEVQDGIAPRMFKAL
IGKGHPEFSTNRQQDAQEFFLHLINMVERNCRSSENPNEVFRFLVEEKIKCLATEKVKYT
QRVDYIMQLPVPMDAALNKEELLEYEEKKRQAEEEKMALPELVRAQVPFSSCLEAYGAPE
QVDDFWSTALQAKSVAVKTTRFASFPDYLVIQIKKFTFGLDWVPKKLDVSIEMPEELDIS
QLRGTGLQPGEEELPDIAPPLVTPDEPKAPMLDESVIIQLVEMGFPMDACRKAVYYTGNS
GAEAAMNWVMSHMDDPDFANPLILPGSSGPGSTSAAADPPPEDCVTTIVSMGFSRDQALK
ALRATNNSLERAVDWIFSHIDDLDAEAAMDISEGRSAADSISESVPVGPKVRDGPGKYQL
FAFISHMGTSTMCGHYVCHIKKEGRWVIYNDQKVCASEKPPKDLGYIYFYQRVAS
Download sequence
Identical sequences K6ZD24
11219 ENSP00000373883 ENSP00000373883 ENSP00000470388 gi|148727247|ref|NP_003472.2| NP_003472.2.87134 NP_003472.2.92137 XP_003820322.1.60992 XP_004052640.1.27298 XP_016778349.1.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]