SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000374358 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000374358
Domain Number 1 Region: 340-440
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 8.1e-25
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.0018
Further Details:      
 
Domain Number 2 Region: 72-137
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 9.95e-17
Family HLH, helix-loop-helix DNA-binding domain 0.0024
Further Details:      
 
Domain Number 3 Region: 156-210,238-257
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.37e-16
Family N-terminal PAS domain of Pas kinase 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000374358   Gene: ENSG00000133794   Transcript: ENST00000389708
Sequence length 526
Comment pep:known chromosome:GRCh37:11:13299378:13408808:1 gene:ENSG00000133794 transcript:ENST00000389708 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADQRMDISSTISDFMSPGPTDLLSSSLGTSGVDCNRKRKGSSTDYQESMDTDKDDPHGR
LEYTEHQGRIKNAREAHSQIEKRRRDKMNSFIDELASLVPTCNAMSRKLDKLTVLRMAVQ
HMKTLRGATNPYTEANYKPTFLSDDELKHLILRAADGFLFVVGCDRGKILFVSESVFKIL
NYSQNDLIGQSLFDYLHPKDIAKVKEQLSSSDTAPRERLIDAKTGLPVKTDITPGPSRLC
SGARRSFFCRMKCNRPSVKVEDKDFPSTCSKKKADRKSFCTIHSTGYLKSWPPTKMGLDE
DNEPDNEGCNLSCLVAIGRLHSHVVPQPVNGEIRVKSMEYVSRHAIDGKFVFVDQRATAI
LAYLPQELLGTSCYEYFHQDDIGHLAECHRQVLQTREKITTNCYKFKIKDGSFITLRSRW
FSFMNPWTKEVEYIVSTNTVVLSRVDTGHLGQVEWCTVLSRPDSRFLIAGMFTEPTSWKA
GTQPSHSSQHPPTAWTACCPLEKVAQRGPTPLFQGFQGEPGLGQEK
Download sequence
Identical sequences ENSP00000374358

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]