SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000374455 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000374455
Domain Number 1 Region: 387-436
Classification Level Classification E-value
Superfamily UBA-like 1.17e-17
Family UBA domain 0.00012
Further Details:      
 
Domain Number 2 Region: 112-173
Classification Level Classification E-value
Superfamily RING/U-box 9.18e-17
Family ZZ domain 0.011
Further Details:      
 
Domain Number 3 Region: 44-97
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.0000000000308
Family PB1 domain 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000374455   Gene: ENSG00000161011   Transcript: ENST00000389805
Sequence length 440
Comment pep:known chromosome:GRCh37:5:179247759:179265078:1 gene:ENSG00000161011 transcript:ENST00000389805 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASLTVKAYLLGKEDAAREIRRFSFCCSPEPEAEAEAAAGPGPCERLLSRVAALFPALRP
GGFQAHYRDEDGDLVAFSSDEELTMAMSYVKDDIFRIYIKEKKECRRDHRPPCAQEAPRN
MVHPNVICDGCNGPVVGTRYKCSVCPDYDLCSVCEGKGLHRGHTKLAFPSPFGHLSEGFS
HSRWLRKVKHGHFGWPGWEMGPPGNWSPRPPRAGEARPGPTAESASGPSEDPSVNFLKNV
GESVAAALSPLGIEVDIDVEHGGKRSRLTPVSPESSSTEEKSSSQPSSCCSDPSKPGGNV
EGATQSLAEQMRKIALESEGRPEEQMESDNCSGGDDDWTHLSSKEVDPSTGELQSLQMPE
SEGPSSLDPSQEGPTGLKEAALYPHLPPEADPRLIESLSQMLSMGFSDEGGWLTRLLQTK
NYDIGAALDTIQYSKHPPPL
Download sequence
Identical sequences Q13501
ENSP00000374455 ENSP00000374455 NP_003891.1.87134 NP_003891.1.92137 9606.ENSP00000374455 ENSP00000374455 HR4537 Q13501 gi|4505571|ref|NP_003891.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]