SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000376214 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000376214
Domain Number 1 Region: 28-133,219-406
Classification Level Classification E-value
Superfamily Phosphoenolpyruvate/pyruvate domain 9.77e-106
Family Pyruvate kinase 0.000000000841
Further Details:      
 
Domain Number 2 Region: 411-542
Classification Level Classification E-value
Superfamily PK C-terminal domain-like 3.4e-40
Family Pyruvate kinase, C-terminal domain 0.000000303
Further Details:      
 
Domain Number 3 Region: 129-230
Classification Level Classification E-value
Superfamily PK beta-barrel domain-like 3.66e-29
Family Pyruvate kinase beta-barrel domain 0.00000123
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000376214   Gene: ENSG00000143627   Transcript: ENST00000392414
Sequence length 543
Comment pep:known chromosome:GRCh37:1:155259630:155270792:-1 gene:ENSG00000143627 transcript:ENST00000392414 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEGPAGYLRRASVAQLTQELGTAFFQQQQLPAAMADTFLEHLCLLDIDSEPVAARSTSII
ATIGPASRSVERLKEMIKAGMNIARLNFSHGSHEYHAESIANVREAVESFAGSPLSYRPV
AIALDTKGPEIRTGILQGGPESEVELVKGSQVLVTVDPAFRTRGNANTVWVDYPNIVRVV
PVGGRIYIDDGLISLVVQKIGPEGLVTQVENGGVLGSRKGVNLPGAQVDLPGLSEQDVRD
LRFGVEHGVDIVFASFVRKASDVAAVRAALGPEGHGIKIISKIENHEGVKRFDEILEVSD
GIMVARGDLGIEIPAEKVFLAQKMMIGRCNLAGKPVVCATQMLESMITKPRPTRAETSDV
ANAVLDGADCIMLSGETAKGNFPVEAVKMQHAIAREAEAAVYHRQLFEELRRAAPLSRDP
TEVTAIGAVEAAFKCCAAAIIVLTTTGRSAQLLSRYRPRAAVIAVTRSAQAARQVHLCRG
VFPLLYREPPEAIWADDVDRRVQFGIESGKLRGFLRVGDLVIVVTGWRPGSGYTNIMRVL
SIS
Download sequence
Identical sequences gi|32967597|ref|NP_870986.1| ENSP00000376214 ENSP00000461487 NP_870986.1.87134 NP_870986.1.92137 ENSP00000376214 ENSP00000461487

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]