SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000377125 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000377125
Domain Number 1 Region: 104-173
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 4.84e-17
Family HLH, helix-loop-helix DNA-binding domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000377125   Gene: ENSG00000105967   Transcript: ENST00000393485
Sequence length 197
Comment pep:known chromosome:GRCh37:7:115580003:115670798:-1 gene:ENSG00000105967 transcript:ENST00000393485 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTLDHQIINPTLKWSQPAVPSGGPLVQHAHTTLDSDAGLTENPLTKLLAIGKEDDNAQWH
LSGSILDVYSGEQGISPINMGLTSASCPSSLPMKREITETDTRALAKERQKKDNHNLIER
RRRYNINYRIKELGTLIPKSNDPDMRWNKGTILKASVEYIKWLQKEQQRARELEHRQKKL
EQANRRLLLRIQVFIRM
Download sequence
Identical sequences ENSP00000377125 GO.35264 ENSP00000377125

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]