SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000377128 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000377128
Domain Number 1 Region: 2-168
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.39e-40
Family GABA-aminotransferase-like 0.00025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000377128   Gene: ENSG00000175309   Transcript: ENST00000393488
Sequence length 182
Comment pep:known chromosome:GRCh37:5:177635624:177649477:-1 gene:ENSG00000175309 transcript:ENST00000393488 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
XVPDIVTMGKSIGNGHPVACVAATQPVARAFEATGVEYFNTFGGSPVSCAVGLAVLNVLE
KEQLQDHATSVGSFLMQLLGQQKIKHPIVGDVRGVGLFIGVDLIKDEATRTPATEEAAYL
VSRLKENYVLLSTDGPGRNILKFKPPMCFSLDNARQVVAKLDAILTDMEEKVRSCETLRL
QP
Download sequence
Identical sequences H7BYK2
ENSP00000377128 ENSP00000377128

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]