SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000377369 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000377369
Domain Number 1 Region: 84-389
Classification Level Classification E-value
Superfamily RNI-like 7.85e-61
Family 28-residue LRR 0.0066
Further Details:      
 
Weak hits

Sequence:  ENSP00000377369
Domain Number - Region: 417-480
Classification Level Classification E-value
Superfamily EF-hand 0.000228
Family Calmodulin-like 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000377369   Gene: ENSG00000100565   Transcript: ENST00000393774
Sequence length 488
Comment pep:known chromosome:GRCh37:14:77292715:77336549:1 gene:ENSG00000100565 transcript:ENST00000393774 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHIQFPSKPTLPRACWEGRITAGSPGMPPDEIEIEPVRQSSDKMLYCEAESPPTVEKVKP
ARENSETDLEIEDDEKFFTTGQKELYLEACKLMGVVPVSYFIRNMEESYVNLNHHGLGPR
GTKAIAIALVSNMAVTKLELEDNCIMEEGVLSLVEMLQENYYLQEMNISNNHLGLEGARI
ISDFFERNSSSIWSLELSGNDFKEDSAALLCQALSTNYQIKKLDLSHNQFSDVGGEHLGQ
MLAINVGLTSLDLSWNNFHTRGAVALCNGLRGNVTLTKLDLSMNGFGNEVALALGEVLRL
NRCLVYLDIGGNDIGNEGASKISKGLESNESLRVLKLFLNPINMDGAILLILAIKRNPKS
RMEELDISNVLVSEQFMKTLDGVYAVHPQLDVVFKAVQGLSPKKTIFLLTNPMKLIQSYA
DQHKITIVDFFKSLNPTGTMKMSVDEFQKVMIEQNKVPLNQYQVREVIKKLDEKTGMVNF
SFLNTMKP
Download sequence
Identical sequences Q0VAA2
ENSP00000377369 NP_919263.2.87134 NP_919263.2.92137 9606.ENSP00000377369 gi|168986655|ref|NP_919263.2| ENSP00000377369 ENSP00000216453

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]