SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000377413 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000377413
Domain Number 1 Region: 92-405
Classification Level Classification E-value
Superfamily PLP-dependent transferases 5.09e-114
Family GABA-aminotransferase-like 0.0000000000473
Further Details:      
 
Weak hits

Sequence:  ENSP00000377413
Domain Number - Region: 43-68
Classification Level Classification E-value
Superfamily Type X cellulose binding domain, CBDX 0.0615
Family Type X cellulose binding domain, CBDX 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000377413   Gene: ENSG00000182199   Transcript: ENST00000393827
Sequence length 408
Comment pep:known chromosome:GRCh37:12:57624151:57628546:1 gene:ENSG00000182199 transcript:ENST00000393827 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGEQRWWMKLSCCASAGPWKPLTWILHSGESMSSPTPGPQPTWPSTQPFCNLTTGSWGWT
CPMGAISPTATCLTSSGYQPRPSSSSLCPISSTALAVCVSVQPKTGLIDYNQLALTARLF
RPRLIIAGTSAYARLIDYARMREVCDEVKAHLLADMAHISGLVAAKVIPSPFKHADIVTT
TTHKTLRGARSGLIFYRKGVKAVDPKTGREIPYTFEDRINFAVFPSLQGGPHNHAIAAVA
VALKQACTPMFREYSLQVLKNARAMADALLERGYSLVSGGTDNHLVLVDLRPKGLDGARA
ERVLELVSITANKNTCPGDRSAITPGGLRLGAPALTSRQFREDDFRRVVDFIDEGVNIGL
EVKSKTAKLQDFKSFLLKDSETSQRLANLRQRVEQFARAFPMPGFDEH
Download sequence
Identical sequences B4DLV4
ENSP00000377413 XP_011536977.1.92137 XP_011536978.1.92137 XP_011536979.1.92137 XP_011536980.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]