SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000377561 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000377561
Domain Number 1 Region: 32-192
Classification Level Classification E-value
Superfamily RNI-like 7.26e-25
Family 28-residue LRR 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000377561   Gene: ENSG00000125122   Transcript: ENST00000393992
Sequence length 223
Comment pep:known chromosome:GRCh37:16:67241043:67260721:-1 gene:ENSG00000125122 transcript:ENST00000393992 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYSSGWPAGAAEPRHGRGRELAQALGCMHGAPSQLASLSLAHCSSLKSRPELEHQASGTK
DACPEPQGPSLLTLRALQELDLTACSKLTDASLAKVLQFLQLRQLSLSLLPELTDNGLVA
VARGCPSLEHLALSHCSRLSDKGWAQAASSWPRLQHLNLSSCSQLIEQTLDAIGQACRQL
RVLDVATCPGINMAAVRRFQAQLPQVSCVQSRFVGGADLTLTL
Download sequence
Identical sequences A0A024R6W8 Q8WV35
gi|16306591|ref|NP_036295.1| gi|51873034|ref|NP_001004055.1| NP_001004055.1.87134 NP_001004055.1.92137 NP_036295.1.87134 NP_036295.1.92137 XP_016878620.1.92137 XP_016878621.1.92137 XP_016878622.1.92137 XP_016878623.1.92137 ENSP00000344364 ENSP00000377561 ENSP00000386622 ENSP00000387318 9606.ENSP00000344364 ENSP00000344364 ENSP00000377561 ENSP00000386622 ENSP00000387318

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]