SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000377598 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000377598
Domain Number 1 Region: 265-308
Classification Level Classification E-value
Superfamily UBA-like 0.0000323
Family UBA domain 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000377598   Gene: ENSG00000114423   Transcript: ENST00000394030
Sequence length 321
Comment pep:putative chromosome:GRCh37:3:105374305:105421045:-1 gene:ENSG00000114423 transcript:ENST00000394030 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GITASSNVNGRHSRVGSDPVLMRKHRRHDLPLEGAKVFSNGHLGSEEYDVPPRLSPPPPV
TTLLPSIKCTGPLANSLSEKTRDPVEEDDDEYKIPSSHPVSLNSQPSHCHNVKPPVRSCD
NGHCMLNGTHGPSSEKKSNIPDLSIYLKGEDAFDALPPSLPPPPPPARHSLIEHSKPPGS
SSRPSSGQDLFLLPSDPFVDLASGQVPLPPARRLPGENVKTNRTSQDYDQLPSCSDGSQA
PARPPKPRPRRTAPEIHHRKPHGPEAALENVDAKIAKLMGEGYAFEEVKRALEIAQNNVE
VARSILREFAFPPPVSPRLNL
Download sequence
Identical sequences A0A2J8MXJ8 Q68CY2
ENSP00000377598 ENSP00000377598

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]