SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000377680 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000377680
Domain Number 1 Region: 211-383
Classification Level Classification E-value
Superfamily C-type lectin-like 3.15e-52
Family C-type lectin domain 0.00000000862
Further Details:      
 
Weak hits

Sequence:  ENSP00000377680
Domain Number - Region: 95-159
Classification Level Classification E-value
Superfamily occludin/ELL-like 0.000824
Family Occludin/ELL domain 0.0046
Further Details:      
 
Domain Number - Region: 142-205
Classification Level Classification E-value
Superfamily occludin/ELL-like 0.00405
Family Occludin/ELL domain 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000377680   Gene: ENSG00000104938   Transcript: ENST00000394122
Sequence length 387
Comment pep:known chromosome:GRCh37:19:7828035:7834490:1 gene:ENSG00000104938 transcript:ENST00000394122 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSDSKEPRVQQLGLLEEDPTTNFQFQQIHGHKSSTGCLGHGALVLQLLSFMLLAGVLPRL
SKVPSSLSQEQSEQDAIYQNLTQLKAAVGELSEKSKLQEIYQELTQLKAAVGELPEKSKL
QEIYQELTRLKAAVGELPEKSKLQEIYQELTRLKAAVGELPEKSKLQEIYQELTRLKAAV
GELPEKSKLQEIYQELTELKAAVGELPEKSKLQEIYQELTQLKAAVGELPDQSKQQQIYQ
ELTDLKTAFERLCRHCPKDWTFFQGNCYFMSNSQRNWHDSVTACQEVRAQLVVIKTAEEQ
NFLQLQTSRSNRFSWMGLSDLNQEGTWQWVDGSPLSPSFQRYWNSGEPNNSGNEDCAEFS
GSGWNDNRCDVDNYWICKKPAACFRDE
Download sequence
Identical sequences E7ENS9
ENSP00000377680 ENSP00000377680

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]