SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000378053 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000378053
Domain Number 1 Region: 21-281
Classification Level Classification E-value
Superfamily DNase I-like 7.85e-45
Family DNase I-like 0.000000624
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000378053   Gene: ENSG00000163687   Transcript: ENST00000394549
Sequence length 305
Comment pep:known chromosome:GRCh37:3:58178355:58196950:-1 gene:ENSG00000163687 transcript:ENST00000394549 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRELAPLLLLLLSIHSALAMRICSFNVRSFGESKQEDKNAMDVIVKVIKRCDIILVMEI
KDSNNRICPILMEKLNRNSRRGITYNYVISSRLGRNTYKEQYAFLYKEKLVSVKRSYHYH
DYQDGDADVFSREPFVVWFQSPHTAVKDFVIIPLHTTPETSVKEIDELVEVYTDVKHRWK
AENFIFMGDFNAGCSYVPKKAWKNIRLRTDPRFVWLIGDQEDTTVKKSTNCAYDRIVLRG
QEIVSSVVPKSNSVFDFQKAYKLTEEEALDVSDHFPVEFKLQSSRAFTNSKKSVTLRKKT
KSKRS
Download sequence
Identical sequences A0A024R365 Q13609
NP_004935.1.87134 NP_004935.1.92137 ENSP00000417047 ENSP00000316193 ENSP00000378053 gi|4826698|ref|NP_004935.1| ENSP00000378053 9606.ENSP00000316193

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]