SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000378327 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000378327
Domain Number 1 Region: 296-358
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.3e-19
Family LIM domain 0.0029
Further Details:      
 
Domain Number 2 Region: 237-299
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.04e-18
Family LIM domain 0.01
Further Details:      
 
Domain Number 3 Region: 355-417
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 3.15e-16
Family LIM domain 0.0062
Further Details:      
 
Domain Number 4 Region: 414-444
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000931
Family LIM domain 0.01
Further Details:      
 
Domain Number 5 Region: 209-235
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000104
Family LIM domain 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000378327   Gene: ENSG00000140682   Transcript: ENST00000394858
Sequence length 444
Comment pep:known chromosome:GRCh37:16:31484526:31489281:1 gene:ENSG00000140682 transcript:ENST00000394858 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPRSGAPKERPAEPLTPPPSYGHQPQTGSGESSGASGDKDHLYSTVCKPRSPKPAAPAAP
PFSSSSGVLGTGLCELDRLLQELNATQFNITDEIMSQFPSSKVASGEQKEDQSEDKKRPS
LPSSPSPGLPKASATSATLELDRLMASLSDFRVQNHLPASGPTQPPVVSSTNEGSPSPPE
PTGKGSLDTMLGLLQSDLSRRGVPTQAKGLCGSCNKPIAGQVVTALGRAWHPEHFVCGGC
STALGGSSFFEKDGAPFCPECYFERFSPRCGFCNQPIRHKMVTALGTHWHPEHFCCVSCG
EPFGDEGFHEREGRPYCRRDFLQLFAPRCQGCQGPILDNYISALSALWHPDCFVCRECFA
PFSGGSFFEHEGRPLCENHFHARRGSLCATCGLPVTGRCVSALGRRFHPDHFTCTFCLRP
LTKGSFQERAGKPYCQPCFLKLFG
Download sequence
Identical sequences A0A024QZE7 A0A2J8J576
NP_001158191.1.87134 NP_001158191.1.92137 NP_057011.2.87134 NP_057011.2.92137 XP_009428970.1.37143 ENSP00000355117 ENSP00000378327 ENSP00000457586 gi|21361591|ref|NP_057011.2| gi|257900476|ref|NP_001158191.1| ENSP00000355117 ENSP00000378327 ENSP00000457586

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]