SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000379100 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000379100
Domain Number 1 Region: 66-137
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 1.96e-20
Family HLH, helix-loop-helix DNA-binding domain 0.0000143
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000379100   Gene: ENSG00000072310   Transcript: ENST00000395751
Sequence length 216
Comment pep:known chromosome:GRCh37:17:17715387:17724178:-1 gene:ENSG00000072310 transcript:ENST00000395751 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MKTDGATVKAAGLSPLVSGTTVQTGPLPTLVSGGTILATVPLVVDAEKLPINRLAAGSKA
PASAQSRGEKRTAHNAIEKRYRSSINDKIIELKDLVVGTEAKLNKSAVLRKAIDYIRFLQ
HSNQKLKQENLSLRTAVHKSKSLKDLVSACGSGGNTDVLMEGVKTEVEDTLTPPPSDAGS
PFQSSPLSLGSRGSGSGGSGSDSEPDSPVFEDSKTE
Download sequence
Identical sequences A0A2I3SG01 X6RBE4
ENSP00000379100 ENSP00000379100

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]