SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000379238 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000379238
Domain Number 1 Region: 333-433
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 3.77e-25
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.00097
Further Details:      
 
Domain Number 2 Region: 68-138
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000000000000379
Family HLH, helix-loop-helix DNA-binding domain 0.0029
Further Details:      
 
Domain Number 3 Region: 154-208,236-250
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000000000000768
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000379238   Gene: ENSG00000029153   Transcript: ENST00000395901
Sequence length 599
Comment pep:known chromosome:GRCh37:12:27485853:27573466:1 gene:ENSG00000029153 transcript:ENST00000395901 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAEEEAAAGGEVAGGEATAPGKVLREENQCIAPVVSSRVSPGTRPTAMGSFSSHMTEFP
RKRKGSDSDPSQEAHSQTEKRRRDKMNNLIEELSAMIPQCNPMARKLDKLTVLRMAVQHL
RSLKGLTNSYVGSNYRPSFLQDNELRHLILKTAEGFLFVVGCERGKILFVSKSVSKILNY
DQASLTGQSLFDFLHPKDVAKVKEQLSSFDISPREKLIDAKTGLQVHSNLHAGRTRVYSG
SRRSFFCRIKSCKISVKEEHGCLPNSKKKEHRKFYTIHCTGYLRSWPPNIVGMEEERNSK
KDNSNFTCLVAIGRLQPYIVPQNSGEINVKPTEFITRFAVNGKFVYVDQRATAILGYLPQ
ELLGTSCYEYFHQDDHNNLTDKHKAVLQSKEKILTDSYKFRAKDGSFVTLKSQWFSFTNP
WTKELEYIVSVNTLVLGHSEPGEASFLPCSSQSSEESSRQSCMSVPGMSTGTVLGAGSIG
TDIANEILDLQRLQSSSYLDDSSPTGLMKDTHTVNCRSMSNKELFPPSPSEMGELEATRQ
NQSTVAVHSHEPLLSDGAQLDFDALCDNDDTAMAAFMNYLEAEGGLGDPGDFSDIQWTL
Download sequence
Identical sequences NP_001234932.1.87134 NP_001234932.1.92137 ENSP00000379238 ENSP00000379238

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]