SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000380494 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000380494
Domain Number 1 Region: 311-391
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 4.97e-19
Family HLH, helix-loop-helix DNA-binding domain 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000380494   Gene: ENSG00000116990   Transcript: ENST00000397332
Sequence length 394
Comment pep:putative chromosome:GRCh37:1:40361098:40367685:-1 gene:ENSG00000116990 transcript:ENST00000397332 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCVCAGCRAAPSRRGAGPLQVAGGWSEGADMDYDSYQHYFYDYDCGEDFYRSTAPSEDIW
KKFELVPSPPTSPPWGLGPGAGDPAPGIGPPEPWPGGCTGDEAESRGHSKGWGRNYASII
RRDCMWSGFSARERLERAVSDRLAPGAPRGNPPKASAAPDCTPSLEAGNPAPAAPCPLGE
PKTQACSGSESPSDSENEEIDVVTVEKRQSLGIRKPVTITVRADPLDPCMKHFHISIHQQ
QHNYAARFPPESCSQEEASERGPQEEVLERDAAGEKEDEEDEEIVSPPPVESEAAQSCHP
KPVSSDTEDVTKRKNHNFLERKRRNDLRSRFLALRDQVPTLASCSKAPKVVILSKALEYL
QALVGAEKRMATEKRQLRCRQQQLQKRIAYLTGY
Download sequence
Identical sequences gi|296923785|ref|NP_001028254.2| ENSP00000380494 ENSP00000380494 NP_001028254.2.87134 NP_001028254.2.92137 ENSP00000361902

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]