SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000380702 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000380702
Domain Number - Region: 45-90
Classification Level Classification E-value
Superfamily Delta-sleep-inducing peptide immunoreactive peptide 0.00209
Family Delta-sleep-inducing peptide immunoreactive peptide 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000380702   Gene: ENSG00000214114   Transcript: ENST00000397572
Sequence length 103
Comment pep:known chromosome:GRCh37:1:39328636:39339777:-1 gene:ENSG00000214114 transcript:ENST00000397572 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAHYKAADSKREQFRRYLEKSGVLDTLTKVLVALYEEPEKPNSALDFLKHHLGAATPENP
EIELLRLELAEMKEKYEAIVEENKKLKAKLAQYEPPQEEKRAE
Download sequence
Identical sequences A0A0D9S7Q0 A0A2K6U5Y7 F7GS32 G7NUB6 H0XJ67 H2PYQ5 Q99417
ENSP00000380702 ENSGGOP00000005689 ENSPTRP00000000986 ENSMMUP00000040415 ENSP00000380702 ENSGGOP00000005689 NP_036465.2.87134 NP_036465.2.92137 XP_003415559.1.64505 XP_003799049.2.62490 XP_004371974.1.4749 XP_008149382.1.99482 XP_010344754.1.74449 GO.33777 ENSOGAP00000016157 9606.ENSP00000380702 ENSPTRP00000000986 ENSP00000380702 ENSOGAP00000016157 gi|57242777|ref|NP_036465.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]