SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000380984 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000380984
Domain Number - Region: 39-65
Classification Level Classification E-value
Superfamily Plexin repeat 0.00994
Family Plexin repeat 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000380984   Gene: ENSG00000183255   Transcript: ENST00000397887
Sequence length 107
Comment pep:novel chromosome:GRCh37:21:46269500:46293624:-1 gene:ENSG00000183255 transcript:ENST00000397887 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPGVARGPTPYWRLRLGGAALLLLLIPVAAAQEPPGAACSQNTNKTCEECLKNVSCLWC
NTNKACLDYPVTSVLPPASLCKLSSARWGVCWGLFKEENPYARFENN
Download sequence
Identical sequences A0A2J8RSC2 A8MZH8
ENSP00000380984 ENSP00000380984

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]