SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000381120 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000381120
Domain Number 1 Region: 408-616
Classification Level Classification E-value
Superfamily RNI-like 2.75e-17
Family 28-residue LRR 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000381120   Gene: ENSG00000153815   Transcript: ENST00000398040
Sequence length 620
Comment pep:known chromosome:GRCh37:16:81678963:81744143:1 gene:ENSG00000153815 transcript:ENST00000398040 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASVAQKKIYKYKKVLSNPSRWEVVLKEIRTLVDMALTSPLQDDSINQAPLEIVSKLLSE
NTNLTTQEHENIIVAIAPLLENNHPPPDLCEFFCKHCRERPRSMVVIEVFTPVVQRILKH
NMDFGKCPRLRLFTQEYILALNELNAGMEVVKKFIQSMHGPTGHCPHPRVLPNLVAVCLA
AIYSCYEEFINSRDNSPSLKEIRNGCQQPCDRKPTLPLRLLHPSPDLVSQEATLSEARLK
SVVVASSEIHVEVERTSTAKPALTASAGNDSEPNLIDCLMVSPACSTMSIELGPQADRTL
GCYVEILKLLSDYDDWRPSLASLLQPIPFPKEALAHEKFTKELKYVIQRFAEDPRQEVHS
CLLSVRAGKDGWFQLYSPGGVACDDDGELFASMVHILMGSCYKTKKFLLSLAENKLGPCM
LLALRGNQTMVEILCLMLEYNIIDNNDTQLQIISTLESTDVGKRMYEQLCDRQRELKELQ
RKGGPTRLTLPSKSTDADLARLLSSGSFGNLENLSLAFTNVTSACAEHLIKLPSLKQLNL
WSTQFGDAGLRLLSEHLTMLQVLNLCETPVTDAGLLALSSMKSLCSLNMNSTKLSADTYE
DLKAKLPNLKEVDVRYTEAW
Download sequence
Identical sequences A0A1D5RI12 A0A2I2YTU9 A0A2I3MUA4 A0A2J8LEH8 A0A2J8T9U8 A0A2K5KV71 A0A2K5WR20 A0A2K6A1C7 A0A2K6MZN9 A0A2K6PYT7 A0A2K6S086
XP_003938112.1.74449 XP_011845458.1.47321 XP_016785725.1.37143 XP_017397352.1.71028 ENSP00000381120 ENSP00000381120

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]