SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000382032 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000382032
Domain Number 1 Region: 36-131
Classification Level Classification E-value
Superfamily Immunoglobulin 1.45e-29
Family C1 set domains (antibody constant domain-like) 0.00000416
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000382032   Gene: ENSG00000179344   Transcript: ENST00000399082
Sequence length 134
Comment pep:novel chromosome:GRCh37:6:32627244:32634429:-1 gene:ENSG00000179344 transcript:ENST00000399082 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSWKKALRIPGDLRVATVTLMLAMLSSLLAEGRDSPVEPTVTISPSRTEALNHHNLLVCS
VTDFYPGQIKVRWFRNDQEETAGVVSTPLIRNGDWTFQILVMLEMTPQRGDVYTCHVEHP
SLQSPITVEWRLLH
Download sequence
Identical sequences A2AAY8
ENSP00000382032 ENSP00000382032

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]