SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000383645 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000383645
Domain Number 1 Region: 121-219
Classification Level Classification E-value
Superfamily Immunoglobulin 3.73e-26
Family I set domains 0.000013
Further Details:      
 
Domain Number 2 Region: 27-119
Classification Level Classification E-value
Superfamily Immunoglobulin 3.81e-25
Family I set domains 0.0034
Further Details:      
 
Domain Number 3 Region: 221-317
Classification Level Classification E-value
Superfamily Immunoglobulin 1.98e-23
Family I set domains 0.00000953
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000383645   Gene: ENSG00000215764   Transcript: ENST00000400847
Sequence length 387
Comment pep:known supercontig:GRCh37:GL000209.1:7904:84658:1 gene:ENSG00000215764 transcript:ENST00000400847 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLMVVSMACVGLFLVQRAGPHMGGQDKPFLSAWPSAVVPRGGHVTLRCHYRHRFNNFML
YKEDRIHVPIFHGRIFQEGFNMSPVTTAHAGNYTCRGSHPHSPTGWSAPSNPMVIMVTGN
HRKPSLLAHPGPLVKSGERVILQCWSDIMFEHFFLHKEWISKDPSRLVGQIHDGVSKANF
SIGSMMRALAGTYRCYGSVTHTPYQLSAPSDPLDIVVTGLYEKPSLSAQPGPKVQAGESV
TLSCSSRSSYDMYHLSREGGAHERRLPAVRKVNRTFQADFPLGPATHGGTYRCFGSFRHS
PYEWSDPSDPLLVSVTGNPSSSWPSPTEPSSKSGNLRHLHILIGTSVVKIPFTILLFFLL
HRWCSNKKNAAVMDQEPAGNRSEQRGF
Download sequence
Identical sequences ENSP00000477733 ENSP00000477859 ENSP00000480199 ENSP00000481993 ENSP00000483460 ENSP00000484010 NYSGRC-IgSF-KI3S1_HUMAN ENSP00000383645

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]