SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000383998 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000383998
Domain Number 1 Region: 87-156
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000000000000209
Family HLH, helix-loop-helix DNA-binding domain 0.0013
Further Details:      
 
Weak hits

Sequence:  ENSP00000383998
Domain Number - Region: 145-235
Classification Level Classification E-value
Superfamily FMN-dependent nitroreductase-like 0.0199
Family NADH oxidase/flavin reductase 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000383998   Gene: ENSG00000112561   Transcript: ENST00000406563
Sequence length 334
Comment pep:novel chromosome:GRCh37:6:41651716:41658780:-1 gene:ENSG00000112561 transcript:ENST00000406563 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HFQSPPPVPGEVLKLDDVIDNIMRLDDVLGYINPEMQMPNTLPLSSSHLNVYSSDPQVTA
SLVGVTSSSCPADLTQKRELTDAESRALAKERQKKDNHNLIERRRRFNINDRIKELGMLI
PKANDLDVRWNKGTILKASVDYIRRMQKDLQKSRELENHSRRLEMTNKQLWLRIQELEMQ
ARVHGLPTTSPSGMNMAELAQQVVKQELPSEEGPGEALMLGAEVPDPEPLPALPPQAPLP
LPTQPPSPFHHLDFSHSLSFGGREDEGPPGYPEPLAPGHGSPFPSLSKKDLDLMLLDDSL
LPLASDPLLSTMSPEASKASSRRSSFSMEEGDVL
Download sequence
Identical sequences B1AKB5
ENSP00000383998 ENSP00000383998

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]