SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000385327 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000385327
Domain Number 1 Region: 2-101
Classification Level Classification E-value
Superfamily MOSC N-terminal domain-like 4.45e-26
Family MOSC N-terminal domain-like 0.0039
Further Details:      
 
Domain Number 2 Region: 102-260
Classification Level Classification E-value
Superfamily PK beta-barrel domain-like 0.000000000000216
Family MOSC (MOCO sulphurase C-terminal) domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000385327   Gene: ENSG00000186205   Transcript: ENST00000407981
Sequence length 263
Comment pep:putative chromosome:GRCh37:1:220964833:220987730:1 gene:ENSG00000186205 transcript:ENST00000407981 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XFWLVINQEGNMVTARQEPRLVLISLTCDGDTLTLSAAYTKDLLLPIKTPTTNAVHKCRV
HGLEIEGRDCGEATAQWITSFLKSQPYRLVHFEPHMRPRRPHQIADLFRPKDQIAYSDTS
PFLILSEASLADLNSRLEKKVKATNFRPNIVISGCDVYAEVTLCPFGSFLGFDFFFKDSW
DELLIGDVELKRVMACSRCILTTVDPDTGVMSRKEPLETLKSYRQCDPSERKLYGKSPLF
GQYFVLENPGTIKVGDPVYLLGQ
Download sequence
Identical sequences H7BYZ9
ENSP00000385327 ENSP00000385327

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]