SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000385738 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000385738
Domain Number 1 Region: 33-137
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000489
Family G proteins 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000385738   Gene: ENSG00000138036   Transcript: ENST00000406852
Sequence length 201
Comment pep:known chromosome:GRCh37:2:44001188:44022318:1 gene:ENSG00000138036 transcript:ENST00000406852 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPSETLWEIAKAEVEKRGINGSEGDGAEIAEKFVFFIGSKNGGKTTIILRCLDRDEPPKP
TLALEYTYGRRAKGHNTPKDIAHFWELGGGTSLLDLISIPITGDTLRTFSLVLVLDLSKP
NDLWPTMENLLQATKSHVDKVIMKLGKTNAKAVSEMRQKIWNNMPKDHPVSCCLGLLLES
LVPFIVNDNITNNFFRFLCMT
Download sequence
Identical sequences gi|29824427|ref|NP_056337.1| NP_056337.1.87134 NP_056337.1.92137 ENSP00000385738 ENSP00000385738 GO.79275 HR2380

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]