SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000386178 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000386178
Domain Number 1 Region: 105-188
Classification Level Classification E-value
Superfamily E set domains 3.45e-20
Family E-set domains of sugar-utilizing enzymes 0.082
Further Details:      
 
Weak hits

Sequence:  ENSP00000386178
Domain Number - Region: 195-242
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0414
Family HLH, helix-loop-helix DNA-binding domain 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000386178   Gene: ENSG00000221818   Transcript: ENST00000408929
Sequence length 427
Comment pep:putative chromosome:GRCh37:8:25701878:25899004:-1 gene:ENSG00000221818 transcript:ENST00000408929 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCRVLLTHEVMCSRCCEKKSCGNRNETPSDPVIIDRFFLKFFLKCNQNCLKTAGNPRDMR
RFQVVLSTTVNVDGHVLAVSDNMFVHNNSKHGRRARRLDPSEATPCIKAISPSEGWTTGG
AMVIIIGDNFFDGLQVVFGTMLVWSELITPHAIRVQTPPRHIPGVVEVTLSYKSKQFCKG
APGRFIYTALNEPTIDYGFQRLQKVIPRHPGDPERLAKEMLLKRAADLVEALYGTPHNNQ
DIILKRAADIAEALYSVPRNPSQLPALSSSPAHSGMMGINSYGSQLGVSISESTQGNNQG
YIRNTSSISPRGYSSSSTPQQSNYSTSSNSMNGYSNVPMANLGVPGSPGFLNGSPTGSPY
GIMSSSPTVGSSSTSSILPFSSSVFPAVKQKSAFAPVIRPQGSPSPACSSGNGNGFRAMT
GLVVPPM
Download sequence
Identical sequences A0A2J8N8T0 A0A2J8X4Y5 B7Z934
ENSP00000386178 XP_012917285.1.14098 ENSP00000386178

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]