SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000386336 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000386336
Domain Number 1 Region: 9-71
Classification Level Classification E-value
Superfamily UBA-like 0.000000122
Family UBA domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000386336   Gene: ENSG00000196141   Transcript: ENST00000409718
Sequence length 558
Comment pep:known chromosome:GRCh37:2:201170616:201343253:1 gene:ENSG00000196141 transcript:ENST00000409718 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAELNTHVNVKEKIYAVRSVVPNKSNNEIVLVLQQFDFNVDKAVQAFVDGSAIQVLKEWN
MTGKKKNNKRKRSKSKQHQGNKDAKDKVERPEAGPLQPQPPQIQNGPMNGCEKDSSSTDS
ANEKPALIPREKKISILEEPSKALRGVTEGNRLLQQKLSLDGNPKPIHGTTERSDGLQWS
AEQPCNPSKPKAKTSPVKSNTPAAHLEIKPDELAKKRGPNIEKSVKDLQRCTVSLTRYRV
MIKEEVDSSVKKIKAAFAELHNCIIDKEVSLMAEMDKVKEEAMEILTARQKKAEELKRLT
DLASQMAEMQLAELRAEIKHFVSERKYDEELGKAARFSCDIEQLKAQIMLCGEITHPKNN
YSSRTPCSSLLPLLNAHAATSGKQSNFSRKSSTHNKPSEGKAANPKMVSSLPSTADPSHQ
TMPANKQNGSSNQRRRFNPQYHNNRLNGPAKSQGSGNEAEPLGKGNSRHEHRRQPHNGFR
PKNKGGAKNQEASLGMKTPEAPAHSEKPRRRQHAADTSEARPFRGSVGRVSQCNLCPTRI
EVSTDAAVLSVPAVTLVA
Download sequence
Identical sequences A0A024R3V0 K7B777 Q9NUQ6
ENSPTRP00000021844 ENSP00000351503 ENSP00000386336 ENSP00000386730 ENSP00000386931 ENSP00000391467 gi|154426253|ref|NP_001093892.1| gi|154426288|ref|NP_001093893.1| gi|154426310|ref|NP_056350.2| ENSP00000351503 ENSP00000386336 ENSP00000386730 ENSP00000386931 ENSP00000391467 NP_001093892.1.87134 NP_001093892.1.92137 NP_001093893.1.87134 NP_001093893.1.92137 NP_001269664.1.87134 NP_001269664.1.92137 NP_056350.2.87134 NP_056350.2.92137 XP_001170105.1.37143 XP_001170167.1.37143 XP_001170193.2.37143 XP_005246513.1.92137 XP_005246514.1.92137 XP_005246515.1.92137 XP_009442215.1.37143 XP_009442216.1.37143 XP_009442217.1.37143 XP_009442218.1.37143 XP_009442219.1.37143 XP_009442226.1.37143 XP_011509241.1.92137 XP_016804957.1.37143 XP_016804958.1.37143 XP_016804959.1.37143 XP_016804960.1.37143 XP_016804961.1.37143 9606.ENSP00000351503 ENSPTRP00000021844

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]