SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000386451 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000386451
Domain Number 1 Region: 7-131
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.51e-29
Family G proteins 0.00000485
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000386451   Gene: ENSG00000138069   Transcript: ENST00000409892
Sequence length 141
Comment pep:novel chromosome:GRCh37:2:65313989:65357239:-1 gene:ENSG00000138069 transcript:ENST00000409892 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSMNPEYDYLFKLLLIGDSGVGKSCLLLRFAESFNNVKQWLQEIDRYASENVNKLLVGN
KCDLTTKKVVDYTTAKEFADSLGIPFLETSAKNATNVEQSFMTMAAEIKKRMGPGATAGG
AEKSNVKIQSTPVKQSGGGCC
Download sequence
Identical sequences A0A2I2ZPI8 A0A2I3TJL3 A0A2J8XCA2 A0A2K5CB32 A0A2K5PXC2 A0A2K5WIS0 A0A2K6AA97 A0A2K6FBZ9 A0A2K6RNQ1 A0A2K6T2S3 F7H2X5
ENSCJAP00000012528 ENSP00000386451 ENSP00000386451

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]