SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000386523 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000386523
Domain Number 1 Region: 25-65
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000422
Family HLH, helix-loop-helix DNA-binding domain 0.00028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000386523   Gene: ENSG00000059728   Transcript: ENST00000409442
Sequence length 73
Comment pep:known chromosome:GRCh37:2:70142241:70165324:1 gene:ENSG00000059728 transcript:ENST00000409442 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MLPYNNKDRDALKRRNKSKKNNSSSRRAHLRLCLEKLKGLVPLGPESSRHTTLSLLTKAK
LHIKDKYPQHWRC
Download sequence
Identical sequences A0A2J8N460 A0A2J8XBV1 F8WBI0
ENSP00000386523 ENSP00000386523

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]