SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000386600 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000386600
Domain Number 1 Region: 8-71
Classification Level Classification E-value
Superfamily UBA-like 0.0000000383
Family UBA domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000386600   Gene: ENSG00000196141   Transcript: ENST00000409397
Sequence length 265
Comment pep:known chromosome:GRCh37:2:201171595:201334683:1 gene:ENSG00000196141 transcript:ENST00000409397 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAELNTHVNVKEKIYAVRSVVPNKSNNEIVLVLQQFDFNVDKAVQAFVDGSAIQVLKEWN
MTGKKKNNKRKRSKSKQHQGNKDAKDKVERPEAGPLQPQPPQIQNGPMNGCEKDSSSTDS
ANEKPALIPREKKISILEEPSKALRGVTGPNIEKSVKDLQRCTVSLTRYRVMIKEEVDSS
VKKIKAAFAELHNCIIDKEVSLMAEMDKVKEEAMEILTARQKKAEELKRLTDLASQMAEM
QLAELRAEIKHFVSERKYDEELGKA
Download sequence
Identical sequences F8W6C2
ENSP00000386600

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]