SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000386731 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000386731
Domain Number 1 Region: 29-460
Classification Level Classification E-value
Superfamily PLP-dependent transferases 6.13e-69
Family Cystathionine synthase-like 0.0000402
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000386731   Gene: ENSG00000115919   Transcript: ENST00000409512
Sequence length 465
Comment pep:known chromosome:GRCh37:2:143635233:143799741:1 gene:ENSG00000115919 transcript:ENST00000409512 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPSSLELPADTVQRIAAELKCHPTDERVALHLDEEDKLRHFRECFYIPKIQDLPPVDLS
LVNKDENAIYFLGNSLGLQPKMVKTYLEEELDKWAKIAAYGHEVGKRPWITGDESIVGLM
KDIVGANEKEIALMNALTVNLHLLMLSFFKPTPKRYKILLEAKAFPSDHYAIESQLQLHG
LNIEESMRMIKPREGEETLRIEDILEVIEKEGDSIAVILFSGVHFYTGQHFNIPAITKAG
QAKGCYVGFDLAHAVGNVELYLHDWGVDFACWCSYKYLNAGAGGIAGAFIHEKHAHTIKP
ALVGWFGHELSTRFKMDNKLQLIPGVCGFRISNPPILLVCSLHASLEIFKQATMKALRKK
SVLLTGYLEYLIKHNYGKDKAATKKPVVNIITPSHVEERGCQLTITFSVPNKDVFQELEK
RGVVCDKRNPNGIRVAPVPLYNSFHDVYKFTNLLTSILDSAETKN
Download sequence
Identical sequences Q16719
3e9k_A gi|312839880|ref|NP_001186170.1| gi|4504937|ref|NP_003928.1| ENSP00000264170 ENSP00000386731 ENSP00000264170 ENSP00000386731 NP_001186170.1.87134 NP_001186170.1.92137 NP_003928.1.87134 NP_003928.1.92137 9606.ENSP00000264170 ENSP00000264170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]