SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000386807 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000386807
Domain Number - Region: 68-121
Classification Level Classification E-value
Superfamily Multiheme cytochromes 0.0544
Family Di-heme elbow motif 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000386807   Gene: ENSG00000243449   Transcript: ENST00000409248
Sequence length 128
Comment pep:novel chromosome:GRCh37:4:2043720:2045691:1 gene:ENSG00000243449 transcript:ENST00000409248 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRVARRTRNVCRCPRAAGPGVPEPRAAPLPLLAMAPPPACRSPMSPPPPPLLLLLLSLAL
LGARARAEPAGSAVPAQSRPCVDCHAFEFMQRALQDLRKTACSLDARTETLLLQAERRAL
CACWPAGH
Download sequence
Identical sequences ENSP00000386807 ENSP00000386807

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]