SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000386868 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000386868
Domain Number 1 Region: 8-84
Classification Level Classification E-value
Superfamily PDZ domain-like 6.84e-20
Family PDZ domain 0.0000769
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000386868   Gene: ENSG00000120913   Transcript: ENST00000409141
Sequence length 278
Comment pep:known chromosome:GRCh37:8:22437984:22451811:1 gene:ENSG00000120913 transcript:ENST00000409141 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALTVDVAGPAPWGFRITGGRDFHTPIMVTKVAERGKAKDADLRPGDIIVAINGESAEGM
LHAEAQSKIRQSPSPLRLQLDRSQATSPGQTNGDSSLEVLATRFQGSVRTYTESQSSLRS
SYSSPTSLSPRAGSPFSPPPSSSSLTGEAAISRSFQSLACSPGLPAADRLSYSGRPGSRQ
AGLGRAGDSAVLVLPPSPGPRSSRPSMDSEGGSLLLDEDSEVFKMLQENREGRAAPRQSS
SFRLLQEALEAEERGTRLCASRRAGTATPAATPVPTVG
Download sequence
Identical sequences ENSP00000386868 gi|38327612|ref|NP_932159.1| NP_932159.1.87134 NP_932159.1.92137 ENSP00000342035 ENSP00000386868

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]